Catalogue

Research peptides

19 synthetic peptides, each supplied as a lyophilized trifluoroacetate salt at ≥ 98 % purity (RP-HPLC) with per-lot ESI-MS identity. Acetate salts and custom quantities on quotation. Identity data below is reference data; the released lot’s certificate of analysis governs.

Cat. no.	Peptide	Sequence	MW (Da)	CAS	Vial sizes
QB-1001	BPC-157 Tissue & wound-model research	GEPPPGKPADDAGLV	1419.5	137525-51-7	5 · 10 · 25 mg
QB-1002	Thymosin β4 (17–23), acetylated Tissue & wound-model research	Ac-LKKTETQ	889.0	885340-08-9	5 · 10 · 25 mg
QB-1003	GHK-Cu Tissue & wound-model research	GHK · Cu(II)	340.4	89030-95-5	5 · 10 · 25 mg
QB-1004	KPV Tissue & wound-model research	KPV	342.4	67727-97-3	5 · 10 · 25 mg
QB-1005	Ipamorelin Growth-hormone axis	Aib-H-(D-2-Nal)-(D-F)-K-NH2	711.9	170851-70-4	5 · 10 · 25 mg
QB-1006	Mod GRF (1–29) Growth-hormone axis	Y-(D-A)-DAIFTQSYRKVLAQLSARKLLQDILSR-NH2	3367.9	863288-34-0	5 · 10 · 25 mg
QB-1007	Sermorelin Growth-hormone axis	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2	3357.9	86168-78-7	5 · 10 · 25 mg
QB-1008	GHRP-2 Growth-hormone axis	(D-A)-(D-2-Nal)-A-W-(D-F)-K-NH2	818.0	158861-67-7	5 · 10 · 25 mg
QB-1009	GHRP-6 Growth-hormone axis	H-(D-W)-A-W-(D-F)-K-NH2	873.0	87616-84-0	5 · 10 · 25 mg
QB-1010	Hexarelin Growth-hormone axis	H-(D-2-Me-W)-A-W-(D-F)-K-NH2	887.0	140703-51-1	5 · 10 · 25 mg
QB-1011	AOD-9604 Growth-hormone axis	YLRIVQCRSVEGSCGF (C7–C14 disulfide)	1815.1	221231-10-3	5 · 10 · 25 mg
QB-1012	Selank Neuropeptides	TKPRPGP	751.9	129954-34-3	5 · 10 · 25 mg
QB-1013	Semax Neuropeptides	MEHFPGP	813.9	80714-61-0	5 · 10 · 25 mg
QB-1014	DSIP Neuropeptides	WAGGDASGE	848.8	62568-57-4	5 · 10 · 25 mg
QB-1015	Epitalon Neuropeptides	AEDG	390.4	307297-39-8	5 · 10 · 25 mg
QB-1016	Kisspeptin-10 (human) Neuropeptides	YNWNSFGLRF-NH2	1302.4	374675-21-5	5 · 10 · 25 mg
QB-1017	LL-37 (human cathelicidin) Immune & antimicrobial	[LL-37, 37 aa]	4493.3	154947-66-7	5 · 10 · 25 mg
QB-1018	Thymosin α1 Immune & antimicrobial	Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN	3108.3	62304-98-7	5 · 10 · 25 mg
QB-1019	MOTS-c (human) Mitochondrial & metabolic	MRWQEMGYIFYPRKLR	2174.6	1627580-64-6	5 · 10 · 25 mg

MW is the average molecular mass of the free peptide (or complex, where stated). CAS numbers refer to the free peptide unless noted on the product page. Both must match the manufacturer’s COA before a lot is released.

By research area

Five areas, nineteen peptides

Growth-hormone axis

GHRH analogues and growth-hormone secretagogue (GHS-R1a) ligands

Ipamorelin, Mod GRF (1–29), Sermorelin, GHRP-2, GHRP-6, Hexarelin, AOD-9604

Tissue & wound-model research

Peptides used in preclinical repair, migration and fibroblast models

BPC-157, Thymosin β4 (17–23), acetylated, GHK-Cu, KPV

Neuropeptides

Regulatory peptides used in CNS, sleep, pineal and neuroendocrine research

Selank, Semax, DSIP, Epitalon, Kisspeptin-10 (human)

Immune & antimicrobial

Host-defence and immunomodulatory peptides

LL-37 (human cathelicidin), Thymosin α1

Mitochondrial & metabolic

Mitochondria-derived and metabolic signalling peptides

MOTS-c (human)

Scope

Not carried

Semaglutide, tirzepatide, liraglutide, dulaglutide, retatrutide, survodutide, cagrilintide and other GLP-1 / incretin receptor agonists. Active ingredients of authorized or late-stage patented drugs. Supplied only through licensed pharmaceutical channels.
Teriparatide, tesamorelin, bremelanotide (PT-141), oxytocin, gonadorelin, hCG, somatropin, erythropoietin. Active ingredients of drugs authorized in Canada or the United States.
Melanotan II. Named in Health Canada advisories; no legitimate research demand that justifies the diversion risk.
Any peptide under active Canadian patent protection. Regardless of approval status.
Bacteriostatic water, syringes, needles, “kits”, pens, nasal sprays, capsules. Administration formats. QuadBio supplies lyophilized powder for laboratory use only and gives no reconstitution or dosing guidance.

Requests for excluded molecules are declined, including from approved accounts. See Terms of sale, section 4.